PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627652.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 232aa    MW: 26862.4 Da    PI: 6.3981
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627652.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.2e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
   XP_013627652.1 14 RGPWTIEEDHRLMNFILNNGIHCWRIVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding56.94.8e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T  E+e++ +++ qlG++ W++Ia++++ gRt++++k++w++
   XP_013627652.1  67 RGGFTDAEEERIMELHSQLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-20564IPR009057Homeodomain-like
PROSITE profilePS5129413.605961IPR017930Myb domain
SuperFamilySSF466893.48E-2811108IPR009057Homeodomain-like
SMARTSM007171.1E-51363IPR001005SANT/Myb domain
PfamPF002492.6E-111461IPR001005SANT/Myb domain
CDDcd001676.31E-41661No hitNo description
PROSITE profilePS5129426.56762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665117IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1567110IPR001005SANT/Myb domain
CDDcd001671.44E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRRPCCEKI GLKRGPWTIE EDHRLMNFIL NNGIHCWRIV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TDAEEERIME LHSQLGNRWS KIASHFPGRT DNEIKNHWNT KIKKKMKHLG  120
LDPATHEPMN NITDQTESNQ ITKPNMCSTI KEGEETKEQT LKDEVDIGSL FEMQGNEISI  180
SSSSLYSNIS RSESSSNFAE DSISLEQWDL TYMTDPLVPW DFFTNLDDNI FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196220.0AY519622.1 Arabidopsis thaliana MYB transcription factor (At5g14340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627652.11e-174PREDICTED: myb-related protein 315-like
RefseqXP_013714181.11e-174PREDICTED: myb-related protein 315-like
SwissprotP813946e-72MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A0D3B1401e-174A0A0D3B140_BRAOL; Uncharacterized protein
STRINGBra006249.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.11e-121myb domain protein 40